search
Register FREE
price
reduction
year

Companies for sale - Judicial Auctions

Ongoing business for sale from bankruptcy procedures. Make your bid!

If you are interested in buying an ongoing business for sale, browse our auction catalogue and buy a company for sale at the most affordable price! From game rooms to computer repair companies, some of the most exciting business opportunities have been included in our selection. Online auctions offer many advantages: auctions are accessible at all times and bidders can participate in auction from home or office using their own computer; the information about each auction is presented on the website and bidders can review all the documents related to the items before participating in the auction; most important of all, online auctions save time and money, as there is no need to spend money to reach the auction spot. As users participate online, the results are immediately visible on our website without any time delay. The Watchlist feature available in each user's account allows to check in real-time the bidding activity and the relaunches of other participants, as well as to see if an auction has been won or is closing soon. Attending an auction is really easy: register for free and make your offer, manually or through the Proxy Bid. This automatic raise system relaunches your bid on your behalf, according to the maximum price you set. If a higher bid is made, the system will raise your bid; if there is no higher bid, you will automatically win the item, without having followed the auction! Are you ready to buy a company for sale at the best price? Register for free and make your bid!

Auction 2362
Lot 1
Add to Watchlist
-30%
Sale of a Shop of Cosmetics Products - Lot 1 (Auction 2362)

Sale of a company specializing in the sale of perfumes cosmetics accessories clothing and leather goods sold in the shop of Melilli SR The assets include the permissions the concessions and licenses for the exercise of the activity equipment machinery furniture and furnishings the agreements required for the operation of the business branch trademarks and logo the stock of existing goods at the auction date that is sold in full in the state of fact in which it is located Interested parties are invited to register to the website and download from document section Notice of saleThe evaluation is available upon written request

Ongoing business
26/06/2018
09:00
CET
Auction 2362
Add to Watchlist
-30%
Sale of a company specializing in retail of cosmetics - Lot (Auction 2362)
1 Lots

Sale of a company specializing in the sale of perfumes cosmetics accessories clothing and leather goods sold in the shop of Melilli SR Bankruptcy no 7 2016 Court of Siracusa We notifiy that the Procedure has also put on sale the shops located in Catania CT and Augusta SR Visit the link for more information about Catania shop sale AUCTION 2361Visit the link for more information about Augusta shop sale AUCTION 2360Sale in compliance with art 107 co 1 L F Goods are located in Melilli SR Register to the website to download sale and collection terms In order to be able to participate to the auction you must register on the website www industrialdiscount it following the instructions given there and also send it by registered letter with acknowledgment of receipt or hands to be delivered indisputably at the IT Auction s r l In envelope closed and without any sign of acknowledgment within the day of 26 06 2018 at 9 00 irrevocable purchase offer

Ongoing business
26/06/2018
09:00
CET
Auction 2361
Lot 1
Add to Watchlist
-30%
Sale of a Shop of Cosmetics Products - Lot 1 (Auction 2361)

Sale of a company specializing in the sale of perfumes cosmetics accessories clothing and leather goods sold in the shop of Catania CT The assets include goodwill as the aptitude of the complex organized to the production of income know how the permissions the concessions and licenses for the exercise of the activity equipment machinery furniture and furnishings the agreements required for the operation of the business branch trademarks and logo employment agreement Interested parties are invited to register to the website and download from document section Notice of saleThe evaluation is available upon written request

Ongoing business
26/06/2018
09:00
CET
Auction 2361
Add to Watchlist
-30%
Sale of a company specializing in retail of cosmetics - Lot (Auction 2361)
1 Lots

Sale of a company specializing in the sale of perfumes cosmetics accessories clothing and leather goods sold in the shop of Catania CT Bankruptcy no 7 2016 Court of Siracusa We notifiy that the Procedure has also put on sale the shops located in Augusta SR and Melilli SR Visit the link for more information about Augusta shop sale AUCTION 2360Visit the link for more information about Melilli shop sale AUCTION 2362Sale in compliance with art 107 co 1 L F Goods are located in Catania CT Register to the website to download sale and collection terms In order to be able to participate to the auction you must register on the website www industrialdiscount it following the instructions given there and also send it by registered letter with acknowledgment of receipt or hands to be delivered indisputably at the IT Auction s r l In envelope closed and without any sign of acknowledgment within the day of 26 06 2018 at 9 00 irrevocable purchase offer

Ongoing business
26/06/2018
09:00
CET
Auction 2360
Lot 1
Add to Watchlist
-30%
Sale of a Shop of Cosmetics Products - Lot 1 (Auction 2360)

Sale of a company specializing in the sale of perfumes cosmetics accessories clothing and leather goods sold in the shop of Augusta SR The assets include goodwill as the aptitude of the complex organized to the production of income know how the permissions the concessions and licenses for the exercise of the activity equipment machinery furniture and furnishings the agreements required for the operation of the business branch trademarks and logo employment agreement the stock of existing goods at the auction date that is sold in full in the state of fact in which it is located Interested parties are invited to register to the website and download from document section Notice of saleThe evaluation is available upon written request

Ongoing business
26/06/2018
09:00
CET
Auction 2360
Add to Watchlist
-30%
Sale of a company specializing in retail of cosmetics - Lot (Auction 2360)
1 Lots

Sale of a company specializing in the sale of perfumes cosmetics accessories clothing and leather goods sold in the shop of Augusta SR Bankruptcy no 7 2016 Court of Siracusa We notifiy that the Procedure has also put on sale the shops located in Catania CT and Melilli SR Visit the link for more information about Catania shop sale AUCTION 2361Visit the link for more information about Melilli shop sale AUCTION 2362Sale in compliance with art 107 co 1 L F Goods are located in Augusta SR Register to the website to download sale and collection terms In order to be able to participate to the auction you must register on the website www industrialdiscount it following the instructions given there and also send it by registered letter with acknowledgment of receipt or hands to be delivered indisputably at the IT Auction s r l In envelope closed and without any sign of acknowledgment within the day of 26 06 2018 at 9 00 irrevocable purchase offer For further details upon the submission of the bid we recommend to download the avviso di vendita from documentation The Company branch evaluation is available upon written request

Ongoing business
26/06/2018
09:00
CET
Auction 1183
Lot 1
Add to Watchlist
AZ Surgelati Spa - Lot 1 (Auction 1183)

Complesso aziendale AZ SURGELATI S p A in liquidazione avente ad oggetto sociale l attivit di produzione surgelazione e confezionamento pizze situata in Localit Agglomerato Industriale San Marco 81100 Marcianise CE Offerte presentabili secondo le modalit indicate nell avviso di vendita allegato alla sezione documentazione della presente pagina Il complesso aziendale include linee reparto caseificio produzione e surgelazione mozzarellelinee per la produzione di pizze e focacce macchinari per preparazione impasto spezzatrici e arrotondatrici celle di livetizione linee di lamiinazione a farcitura forni etc linee per confezionamento e surgelazioneimpianti varilaboratoriouffici mensa officina e spogliatoialtroSi invitano le parti interessate a registrarsi al sito e a scaricare dalla sezione documentazione Avviso di vendita e modulo offerta irrevocabile di acquistoNotizie azienda e relazione avviamentoPerizia stima beni immobiliPerizia stima beni mobili

Ongoing business
26/06/2018
12:00
CET
Auction 1183
Add to Watchlist
AZ SURGELATI SpA - Lot (Auction 1183)
1 Lots

Bankruptcy n 22 2015 Court of Santa Maria Capua Vetere AZ SURGELATI SpA in liquidation located in San Agglomerated Industrial Location 81100 Marcianise CE a bankrupt company whose business is the production freezing and packaging of pizzas and bakery products Collection of irrevocable offers not later than the 26 06 2018 at 12 00 according to the following methods A Purchase hypothesis of the company as a whole with initial rental period Minimum valuable offer rent for 24 months at 10 500 00 per month equal to the offer already by the procedure plus minimum rebate and at the 25th month total purchase of the company with additional payment of 2 000 000 00 B Purchase hypothesis of the company as a whole without intermediate rental periods Minimum valuable offer 2 240 000 00C Assumption hypothesis of the entire building complex Without basic auction restrictionD Assumption hypothesis of movable and instrumental assets Without basic auction restrictionE Assumptions for the total purchase of all intangible assets Without basic auction restrictionFor all further information regarding the submission of the offer interested parties are invited to register on the site and download from the documentation section Notice of sale and irrevocable offer form of purchaseCompany news and goodwill reportExpert estimate of movable propertyExpert estimate of real estateTHE COMPLEX IS VISIONABLE ON APPOINTMENT THE DAY 15 06 2018 PREVIO APPOINTMENTDescriptive sheet of the property on the portal www realestatediscount com CLICK HERE Further photos available upon request

Ongoing business
26/06/2018
12:00
CET
Auction 3046
Lot 1
Add to Watchlist
Sale of a company dedicated to packaging of clothing - Lot 1 (Auction 3046)

Azienda costituita dal complesso dei beni organizzati per l esercizio dell attivit di confezione in serie di abbigliamento esterno in presenza di contratto di affitto d azienda composta da beni mobili e beni immobili meglio identificata e riassunta in dettaglio all interno della documentazione pubblicata sul sito Il giorno 28 06 2018 alle ore 12 00 IT Auction proceder all apertura delle buste contenenti le offerte irrevocabili di acquisto presentate secondo le modalit sopra descritte e verificata la validit delle offerte presentate proceder ad abilitare sul sito www industrialdiscount it gli offerenti La prima offerta verr automaticamente attribuita al miglior offerente o a colui che ha presentato prima l offerta nel caso in cui pervenissero pi offerte di pari valore L asta al rialzo si aprir il giorno 28 06 2018 alle ore 15 00 e terminer alle ore 17 00 e potranno parteciparvi solo gli offerenti abilitati Per ulteriori informazioni in merito alla presentazione dell offerta e alla composizione del lotto si prega di scaricare dalla sezione documentazione Avviso di vendita Inventario Valutazione

Ongoing business
27/06/2018
12:00
CET
Auction 3046
Add to Watchlist
Sale of a company dedicated to packaging of clothing - Lot (Auction 3046)
1 Lots

Sale of a bankruptcy company whose business object is the production of outdoor clothing in the presence of a company lease Bankruptcy n 126 2017 of the Court of Modena Sale in accordance with Article 107 co 1 L F The assets are located in Carpi MO and can be inspected upon appointmentIn order to attend the auction for the sale of the Company it is necessary that the participant is uniquely identified To this end the participant must send an irrevocable purchase offer by registered letter with acknowledgment of receipt or by hand to be delivered to the IT Auction Srl head office not later than the 27 06 2018 at 12 00 For further information on the presentation of the offer and the lot composition please download from the documentation section Sale notice Inventory Evaluation

Ongoing business
27/06/2018
12:00
CET
Auction 3184
Lot 1
Add to Watchlist
Sale of company branch Miami srl - Lot 1 (Auction 3184)

PUBBLICITA Vendita in unico lotto di ramo dell azienda MIAMI SRL in amministrazione giudiziaria con sede operativa In Milano MI Societ dedita alla vendita al minuto di prodotti di panificio e pasticceria composta da arredi e attrezzature usati NON venduti a misura venduti nello stato di fatto riscontrabile prima della gara recandosi presso la sede per un ispezione previsto un canone di locazione immobile di terzi cos come segue 1 500 00 mensili per il primo anno oltre a spese condominiali e deposito cauzionale A seguire 2 000 00 mensili oltre a spese condominiali Prezzo di vendita 100 000 00 centomila oltre imposte e spese notarili conseguenti alla stipula dell atto pubblico di cessione Il prezzo offerto non potr essere inferiore al 75 prezzo base asta a pena di inefficacia dell offerta medesima Le offerte di acquisto dovranno essere presentate in busta chiusa presso lo studio dell Amministratore Giudiziario Dott Dott Uva Vito Antonio in Milano entro le ore 13 00 di mercoled 27 giugno 2018 Per tutti i dettagli sulla presentazione dell offerta REGISTRATI al sito e scarica l Avviso di Vendita dalla sezione documentazione della presente pagina

Ongoing business
27/06/2018
13:00
CET
Auction 3184
Add to Watchlist
Sale of company branch Miami srl - Lot (Auction 3184)
1 Lots

PUBBLICITA Vendita in unico lotto di ramo dell azienda MIAMI SRL in amministrazione giudiziaria con sede operativa In Milano MI Societ dedita alla vendita al minuto di prodotti di panificio e pasticceria composta da arredi e attrezzature usati NON venduti a misura venduti nello stato di fatto riscontrabile prima della gara recandosi presso la sede per un ispezione previsto un canone di locazione immobile di terzi cos come segue 1 500 00 mensili per il primo anno oltre a spese condominiali e deposito cauzionale A seguire 2 000 00 mensili oltre a spese condominiali Prezzo di vendita 100 000 00 centomila oltre imposte e spese notarili conseguenti alla stipula dell atto pubblico di cessione Il prezzo offerto non potr essere inferiore al 75 prezzo base asta a pena di inefficacia dell offerta medesima Le offerte di acquisto dovranno essere presentate in busta chiusa presso lo studio dell Amministratore Giudiziario Dott Dott Uva Vito Antonio in Milano entro le ore 13 00 di mercoled 27 giugno 2018 Per tutti i dettagli sulla presentazione dell offerta REGISTRATI al sito e scarica l Avviso di Vendita dalla sezione documentazione della presente pagina

Ongoing business
27/06/2018
13:00
CET
Auction 2558
Lot 1
Add to Watchlist
-49%
Comeca spa ongoing business - Lot 1 (Auction 2558)

Lotto composto da tutti i beni mobili attrezzature macchinari impianti mobili e attrezzature d ufficio di propriet della Comeca S p A attualmente affittati ad altra societ in forza di contratto di affitto del ramo d azienda i marchi Comeca Comeca Group EXE Securline le certificazioniil patrimonio tecnologicol avviamento commerciale tutti i nomi i marchi di fabbrica e i brevettiil dominio internet www comeca com il relativo sito i diritti di propriet industriale i progetti i disegni i programmi software e le tecnologie utilizzate nell attivit un nutrito pacchetto di clienticontratti di lavoro dipendente con la previsione di cui all art 105 L F di esclusione della responsabilit dell acquirente per i debiti sorti anteriormente alla domanda di concordato Si comunica che pur sussistendo un prezzo minimo posto a base d asta per l acquisto dei suddetti beni gli interessati potranno presentare proposte di acquisto per qualsiasi importo Ulteriore documentazione disponibile previa sottoscrizione di patto di riservatezza scaricabile dalla sezione documentazione

Ongoing business
28/06/2018
15:00
CET
Auction 2558
Add to Watchlist
-49%
Comeca spa ongoing business branch - Lot (Auction 2558)
1 Lots

Sale of Comeca SpA company branch concerning the production and sale of doors Creditors Agreement n 13 2014 of the Court of Rimini Object of the sale all the assets equipment machinery plants furniture and office equipment owned by Comeca SpA currently leased to another company under the lease contract of the business unit the Comeca Comeca Group brands EXE Securline certifications the technological heritage commercial goodwill all names trademarks and patents the internet domain www comeca com the website the industrial property rights the projects the drawings the software programs and the technologies used in the activity a large package of customers employment contracts with the provision pursuant to art 105 L F exclusion of the buyer s responsibility for the debts arising prior to the request for arrangement Please note that even if there is a minimum amount as starting for the purchase of the aforesaid goods the interested parties may submit purchase proposals for any amount Expression of interest must be delivered by hand or sent by registered mail to the head office of IT Auction s r l Via G Galilei 6 Faenza RA not later than 3 00 pm on the 28st of June 2018 Further documentation available after signing a confidentiality notice that can be downloaded from the documentation section PRICE REDUCED BY 48 8

Ongoing business
28/06/2018
15:00
CET
Auction 2210
Lot 1
Add to Watchlist
-44%
Machinery for the production of polyurethane and plastic elements - Lot 1 (Auction 2210)

Vendita del complesso dei beni mobili strumentali per la produzione di elementi per l industria dell arredamento in poliuretano e plastica Scarica dalla sezione documentazione l elenco beni inclusi nella cessione Si notifica che l azienda attualmente oggetto di un contratto di affitto e all affittuario riconosciuto il diritto di prelazione sull acquisto del complesso dei beni mobili aziendali Scarica l Avviso di vendita dalla sezione documentazione vendita

Ongoing business
03/07/2018
12:00
CET
Auction 2210
Add to Watchlist
-44%
Ongoing business production of polyurethane and plastic elements - Lot (Auction 2210)
1 Lots

Bando di cessione dal ramo di azienda specializzato nella attivit di produzione di elementi per l industria dell arredamento in poliuretano e plastica Concordato Preventivo n 18 2013 del Tribunale di Urbino Vendita ai sensi dell art 107 co 1 L F Dalla sezione documentazione scarica l avviso di vendita per prendere nota di tutte le istruzioni per la preparazione dell offerta che dovr pervenire presso gli uffici di IT Auction S r l entro e non oltre marted 03 07 2018 alle ore 12 00 Scarica l Avviso di vendita per i dettagli relativi alla presentazione dell offerta Visita la pagina del lotto per prendere visione della perizia di stima e della documentazione supplementare PREZZI RIDOTTI DEL 44 CIRCA RISPETTO ALLA PERIZIA

Ongoing business
03/07/2018
12:00
CET
Auction 2739
Lot 1
Add to Watchlist
-20%
OMMP SAS ongoing business - Lot 1 (Auction 2739)

Azienda costituita dal complesso dei beni organizzati per l esercizio dell attivit di produzione di stampi per bottiglie in materiale plastico PET composta da beni mobili materiali ed immaterialiLa societ operava nel settore della realizzazione di stampi presso la sede operativa di OsnagoNel 2012 anno anteriore alla dichiarazione di fallimento impiegava 28 dipendenti e aveva un giro d affari di circa 3 259 707 00 Attualmente l Azienda oggetto di contratto di affitto Il contratto di affitto prevede tra l altro il diritto di prelazione a favore dell affittuaria da esercitarsi ai sensi dell art 104 bis l fall entro 5 giorni dal ricevimento della comunicazione di aggiudicazione e l obbligo dell affittuaria di restituire l Azienda entro 120 giorni dalla comunicazione di aggiudicazione stessa la propriet intellettuale di pertinenza le liste clienti il know how commerciale e tecnico e in generale ogni altra informazione inerente all attivit e alla gestione dell Azienda I beni allo stato inclusi nell Azienda sono meglio descritti nell inventario del Fallimento e nella perizia del C T U Dott Ing Antonio Porro redatta il 25 02 2013 L Azienda occupa attualmente 36 dipendenti di cui 21 operai e 15 impiegati al Fallimento non fanno capo altri dipendenti Per ulteriori informazioni si prega di scaricare Avviso di Vendita Perizia di stima

Ongoing business
04/07/2018
09:00
CET
Auction 2739
Add to Watchlist
-20%
OMMP SAS ongoing business - Lot (Auction 2739)
1 Lots

Sale of a bankrupt company whose business object is the mechanical workshop production of molds and similar products Bankruptcy n 36 2013 of the Court of Lecco LC Sale in accordance with Article 107 co 1 L F To be able to attend the auction for the sale of the company it is necessary that the participant is uniquely identified To this end the participant must send an irrevocable purchase offer by registered letter with acknowledgment of receipt or by hand to be delivered without delay to the IT Auction Srl head office not later than the 04 07 2018 at 9 00 the indication of the offered price which can not be lower than the base price under penalty of nullity of the offer equal to Euro 1 233 600 00 The offer must be sent in a sealed envelope and without any sign of recognition The envelope must only mention the words Tribunale di Lecco Fall n 36 2013 In order to inspect the whole complex please contact IT Auction in advance to arrange an appointment sending an e mail to vp industrialdiscount com The assets object of the auction are in Osnago LC For further details on the submission of the offer please download the Notice of Sale from the documentation section

Ongoing business
04/07/2018
09:00
CET
Auction 2066
Lot 3
Add to Watchlist
-70%
Assets complex - Lot 3 (Auction 2066)

This lot is composed by the complex of assets related to dairy production with large areas of production storage and officesDownload assets evaluation from document sectionPrice approximately reduced by 70 in comparison to the evaluation

Ongoing business
04/07/2018
12:00
CET
Auction 2066
Lot 2
Add to Watchlist
-70%
Real estate - Lot 2 (Auction 2066)

This lot is composed by a commercial building The real estate unit is located in Cerreto di Spoleto PG located in Ponte Sargano with access allowed by the Provincial Road 465 This lot is published also on the website www realestatediscount com AUCTION NO 2321 See the following link https www realestatediscount com real estate auctions manufactured for business 2342 Price approximately reduced by 59 in comparison to the evaluation

Ongoing business
04/07/2018
12:00
CET
Auction 2066
Lot 1
Add to Watchlist
-70%
Branch company - Lot 1 (Auction 2066)

This lot is composed of the complex of assets organized for supermarket and hypermarket management activity retail trade and wholesale of food and non food products the supply of food and beverages and the opening of laboratories for packaging and preparation acquisition and driving of cheese factory for the transformation of milk and his derivatives This lot includes both assets and real estate Download the assets evaluation from document sectionPrice approximately reduced by 70 in comparison to the evaluation

Ongoing business
04/07/2018
12:00
CET
Auction 2066
Add to Watchlist
-70%
Sale of the Company branch Ariscount Due srl - Lot (Auction 2066)
3 Lots

Sale of the Company branch Ariscount Due srl The Company is dedicated to the supermarket and hypermarket management activity retail trade and wholesale of food and non food products the supply of food and beverages and the opening of laboratories for packaging and preparation acquisition and driving of cheese factory for the transformation of milk and his derivatives belonging from Bankruptcy n 07 2016 of the Court of Tivoli Sale in compliance with art 107 co 1 L F The goods are located in Cerreto di Spoleto PG The bids may be submitted alternatively for the Company Branch lot no 1 or for the Real Estate Compendium lot no 2 or may be submitted for the Assets Compendium lot no 3 The bids for the Company branch will prevail on possible bids submitted for single lots All the bids reached will be evalueted by Bankruptcy authorities that will give more importance to bids for the sale of Company branch Lot no 1 In order to be able to participate to the auction you must register on the website www industrialdiscount it following the instructions given there and also send it by registered letter with acknowledgment of receipt or hands to be delivered indisputably at the IT Auction s r l In envelope closed and without any sign of acknowledgment within the 04 07 2018 at 12 00 irrevocable purchase offer For further details upon the submission of the bid we recommend to download the avviso di vendita from documentation Download the Company branch evaluation

Ongoing business
04/07/2018
12:00
CET
Auction 3094
Lot 1
Add to Watchlist
Production complex for cat litter - Lot 1 (Auction 3094)

Azienda di produzione e confezionamento di sabbia per lettiere per gatti costituita da beni mobiliimmobiliimmaterialiavviamento commerciale I suddetti beni sono meglio descritti nella perizia di stima scaricabile dalla sezione documentazione I beni si trovano a Cerreto di Spoleto PG e possono esser ispezionati su appuntamento Per ulteriori informazioni sulla presentazione dell offerta scarica il Bando di Vendita dalla sezione documentazione

Ongoing business
04/07/2018
17:00
CET
Auction 3094
Add to Watchlist
Company transfer producer of cat litter - Lot (Auction 3094)
1 Lots

Fallimento n 12 2012 del Tribunale di Perugia Cessione di intero complesso di produzione e confezionamento di sabbia per lettiere per gattiVendita ai sensi dell art 107 co 1 L F Azienda di produzione e confezionamento di sabbia per lettiere per gatti costituita da beni mobiliimmobiliimmaterialiavviamento commerciale I beni si trovano a Cerreto di Spoleto PG e possono esser ispezionati su appuntamento Registrati al sito per scaricare le condizioni di vendita e ritiro Per poter partecipare all asta necessario registrarsi sul sito internet www industrialdiscount it seguendo le istruzioni ivi indicate ed inviare altres a mezzo raccomandata con avviso di ricevimento ovvero a mani da recapitarsi inderogabilmente presso la sede legale di IT Auction s r l in busta chiusa e senza alcun segno di riconoscimento entro il 3 luglio 2018 alle ore 09 00 offerta irrevocabile di acquisto

Ongoing business
04/07/2018
17:00
CET
Auction 3152
Lot 1
Add to Watchlist
Company branch retailing jewelery business - Lot 1 (Auction 3152)

ADVERTISINGBranch of a company operating in the retail trade of jewelery in Milan Via della Spiga 1 from the Creditors Agreement n 23 16 of the Court of VicenzaThe sale of the business branch consists of furnishings electronic office machines n 2 employee relationships the real estate lease Sale in accordance with Article 107 co 1 L F The assets are in Milan MI and can be inspected by appointmentThe methods and conditions for the presentation of the binding offers necessary for participation in the competitive sale procedure with public evidence are indicated in the Regulations published in the virtual data room on the website http www fallimentivicenza com The submission of binding offers must be made by the methods indicated in the Regulations published on the site by delivery or sending to the study of the Liquidator Commissioner by 12 00 on 9 July 2018Minimum price of the business unit 900 000 00 nine hundred thousand 00 corresponding to the price of an irrevocable purchase offer already held by the Liquidator

Ongoing business
09/07/2018
12:00
CET
Auction 3152
Add to Watchlist
Company branch retailing jewelery business - Lot (Auction 3152)
1 Lots

ADVERTISINGBranch of a company operating in the retail trade of jewelery in Milan Via della Spiga 1 from the Creditors Agreement n 23 16 of the Court of VicenzaThe sale of the business branch consists of furnishings electronic office machines n 2 employee relationships the real estate lease Sale in accordance with Article 107 co 1 L F The assets are in Milan MI and can be inspected by appointmentThe methods and conditions for the presentation of the binding offers necessary for participation in the competitive sale procedure with public evidence are indicated in the Regulations published in the virtual data room on the website http www fallimentivicenza com

Ongoing business
09/07/2018
12:00
CET
Auction 3080
Lot 1
Add to Watchlist
Sale of in vitro diagnostic systems manufacturing company - Lot 1 (Auction 3080)

Cessione di azienda di societ fallita comprensiva di know how avente ad oggetto sociale l attivit di produzione di immunodiagnostici e radiodiagnostici in vitro e fornitura di sistemi diagnostici intesi come fornitura di strumenti e reagenti consumabili e prestazioni di servizi ad essi inerenti Fallimento n 93 2014 del Tribunale di Velletri Vendita ai sensi dell art 107 co 1 L F I beni si trovano a Pomezia RM e possono esser ispezionati su appuntamento Per poter partecipare all asta necessario registrarsi sul sito internet www industrialdiscount it seguendo le istruzioni ivi indicate ed inviare altres a mezzo raccomandata con avviso di ricevimento ovvero a mani da recapitarsi inderogabilmente presso la sede legale di IT Auction s r l in busta chiusa e senza alcun segno di riconoscimento entro il 10 luglio 2018 alle ore 09 00 offerta irrevocabile di acquisto Prezzo base d asta 560 610 00Offerta minina pari ad 420 458 00Per ulteriori dettagli in merito alla presentazione dell offerta scarica dalla sezione documentazione Avviso di vendita Perizia di Stima

Ongoing business
10/07/2018
09:00
CET
Auction 3080
Add to Watchlist
Sale of in vitro diagnostic systems manufacturing company - Lot (Auction 3080)
1 Lots

Cessione di azienda di societ fallita comprensiva di know how avente ad oggetto sociale l attivit di produzione di immunodiagnostici e radiodiagnostici in vitro e fornitura di sistemi diagnostici intesi come fornitura di strumenti e reagenti consumabili e prestazioni di servizi ad essi inerenti Fallimento n 93 2014 del Tribunale di Velletri Vendita ai sensi dell art 107 co 1 L F I beni si trovano a Pomezia RM e possono esser ispezionati su appuntamento Per poter partecipare all asta necessario registrarsi sul sito internet www industrialdiscount it seguendo le istruzioni ivi indicate ed inviare altres a mezzo raccomandata con avviso di ricevimento ovvero a mani da recapitarsi inderogabilmente presso la sede legale di IT Auction s r l in busta chiusa e senza alcun segno di riconoscimento entro il 10 luglio 2018 alle ore 09 00 offerta irrevocabile di acquisto Prezzo base d asta 560 610 00Offerta minina pari ad 420 458 00Per ulteriori dettagli in merito alla presentazione dell offerta scarica dalla sezione documentazione Avviso di vendita Perizia di Stima

Ongoing business
10/07/2018
09:00
CET
Auction 3150
Lot 1
Add to Watchlist
Sale of Borsalino Giuseppe Fratello Spa company - Lot 1 (Auction 3150)

ADVERTISING Sale of the Company of BORSALINO GIUSEPPE FRATELLO SPA a company whose business purpose is essentially the activity of production and trade of hats of hair wool straw hats and any other type of headgear as well as accessories such as ribbons linings moroccans etc as well as the preparation processing and trade of fur and other raw materials such as the industry and the trade of clothing articles in general or with similar or related and other articles of fabric of any gender The sale consists of Equity assets real estate technical tools electronic machinery and furniture Employment contractsContracts indicated in the document inserted in the VDROf the distinctive signs present in the Bankruptcy assets excluding the Borsalino trademarks of which the Procedure is not at present proprietary Binding offers must be delivered under penalty of exclusion within the peremptory deadline of 16 00 on 12 July 2018 at the office of the Legal receveir Stefano Ambrosini Base Price 7 814 496 97 EuroThe assets are located in Alessandria AL and Rome RM FOR FURTHER DETAILS DOWNLOAD THE PDF PERIZIA AND BANDO DI VENDITA FROM THE DOCUMENTATION SECTION

Ongoing business
12/07/2018
16:00
CET
Auction 3150
Add to Watchlist
Sale of Borsalino Giuseppe Fratello Spa company - Lot (Auction 3150)
1 Lots

ADVERTISING Sale of the Company of BORSALINO GIUSEPPE FRATELLO SPA a company whose business purpose is essentially the activity of production and trade of fur hats wool straw hats and any other type of headgear as well as accessories such as ribbons linings moroccans etc as well as the preparation processing and trade of fur and other raw materials such as the industry and the trade of clothing articles in general or with similar or related and other articles of fabric of any kind The sale consists of Equity assets real estate technical tools electronic machinery and furniture Employment contracts Contracts indicated in the document inserted in the VDR Of the distinctive signs present in the Bankruptcy assets excluding the Borsalino trademarks of which the Procedure is not at present proprietary Binding offers must be delivered under penalty of exclusion within the peremptory deadline of 16 00 on 12 July 2018 at the office of the Legal receveir Stefano Ambrosini Base Price 7 814 496 97 Euro

Ongoing business
12/07/2018
16:00
CET
Auction 1114
Add to Watchlist
Sale of ongoing business Fiba Spa clothing manufacturing - Lot (Auction 1114)
24 Lots

Sale of an ongoing business concerning manufacturing and sale of clothing Creditors Agreement Fiba Spa in liquidation n 7 2009 of the Court of Perugia It consists in an ongoing business of a company dealing with manufacturing and sale of clothing and knitwear in particular specializing in cashmere and valuable yarns home textile articles leatherwork gift items and travel articles This sale includes equipment and machines annexed to production facilities vehicles brands building raw materials warehouse composed by textiles and yarns and the accessories warehouse We highly recommend the users to register to our Webiste and to download the following documentation Notification of sellingImmovable and movable goods evaluation FibaBrands evaluationNegocio de arrendamientoIn order to attend this auction it is necessary to pay a deposit of Euro 1 685 000 and to send the documentation required to itauction pec itDocumentation must arrive within 9 00 a m of the July 16 2018

Ongoing business
17/07/2018
15:00
CET
Auction 3180
Lot 1
Add to Watchlist
Sale of glass containers distribution company branch - Lot 1 (Auction 3180)

Concordato preventivo Fallimento n 10 2014 del Tribunale di Siena Ramo di azienda in funzionamento organizzato per il commercio all ingrosso e al dettaglio di bottiglie e di contenitori ed imballi in genere e per l attivit di impagliatura e riscelta di fiaschi e bottiglie comprensivo dell avviamento inerente se e in quanto sussistente e dei beni materiali mobili che si precisa composti da impiantiautomezziattrezzaturepermessilicenzeautorizzazioni concessioni o simili per il suo esercizio I beni si trovano a Poggibonsi SI Frazione Pian dei Peschi e possono esser ispezionati su appuntamento Si d atto che l azienda attualmente concessa in affitto e che nello stesso contratto di affitto di azienda contenuta offerta irrevocabile d acquisto del ramo d azienda per il valore complessivo di 192 000 00 euro centonovantaduemila 00 pertanto il prezzo offerto non potr essere inferiore ad 193 000 00 pari al rilancio minimo di 1 000 00 in aggiunta all offerta a mani delle Procedure Per poter partecipare all asta necessario registrarsi sul sito internet www industrialdiscount it seguendo le istruzioni ivi indicate ed inviare altres a mezzo raccomandata con avviso di ricevimento ovvero a mani da recapitarsi inderogabilmente presso la sede legale di IT Auction s r l in Via Galilei n 6 in busta chiusa e senza alcun segno di riconoscimento entro il 20 07 2018 alle ore 09 00 offerta irrevocabile di acquisto Registrati al sito per scaricare le condizioni di vendita e ritiro La Procedura non iscritta al VIES pertanto agli aggiudicatari europei sar richiesto il pagamento dell IVA Download the technical data sheet PDF from the lot documentation section

Ongoing business
20/07/2018
17:00
CET
Auction 3180
Add to Watchlist
Sale of glass containers distribution company branch - Lot (Auction 3180)
1 Lots

Creditors Agreement no 10 2014 of the Court of Siena Company branch in operation organized for the wholesale and retail trade of bottles containers and packaging and for the activity of straw and flasks and bottles including the goodwill inherent if and as subsistent and of movable tangible assets that are composed of installationsvehiclesfacilitypermitslicensingconcessions or similar authorizations for its exerciseemployee contractsThe assets are located in Poggibonsi SI Frazione Pian dei Peschi and can be inspected upon appointment We remind that the company is currently leased and that the irrevocable purchase offer of the business unit is contained in the same company lease contract for a total value of 192 000 00 one hundred and ninety two thousand 00 therefore the price offered can not be less than 193 000 00 equal to the minimum increase of 1 000 00 in addition to the offer by the hands of the Procedures In order to attend the auction it is necessary to register on the website www industrialdiscount it by following the instructions indicated therein and send also by registered mail with acknowledgment of receipt or by hand to be delivered to the registered office of IT Auction s r l in Via Galilei n 6 in a sealed envelope and without any sign of recognition within and not later than the 20 07 2018 at 09 00 irrevocable purchase offer For further information about the assets on sale and on how to make the offer download from the documentation section Sale notice Annex A corresponding to the assets evaluation

Ongoing business
20/07/2018
17:00
CET
Auction 2264
Add to Watchlist
-49%
Sale of plastic processing company - Lot (Auction 2264)
1 Lots

Sale of a company dedicated to the processing and distribution of plastic materials composed by the complex of goods organized for the operation of the processing distribution and trade of plastic materials consisting of assets and immaterial goods Bankruptcy No 12 2017 Court of Forl The assets are best described in the assets evaluations attached to the documentation section of this pageIn order to be able to attend the auction for the sale of the Company the participant must be uniquely identified To this end the participant must send an irrevocable purchase offer stamp of 16 00 by regular post or hands to be delivered at IT Auction Srl head office not later than 9 00 am on 23 07 2018Given that the company is today leased to an economic operator with an annual duration up to 27 5 2018 renewable annually unless notice is given at least six months before the original or renewed maturity date so by November 27 of each year the annual fee of 20 400 00 over VAT the same contract also provides for the possibility of transferor and tenant in the case of prior agreement or bankruptcy to withdraw from the contract with a notice of at least two months to enable the fulfillment of the obligations assumed For all bidding instructions please download the sales notice from the documentation sectionPRICE REDUCED BY 49

Ongoing business
23/07/2018
09:00
CET
Auction 2195
Lot 1
Add to Watchlist
-68%
Company branch of a hotel complex - Lot 1 (Auction 2195)

Hotel owned business area consisting of a hotel complex restaurant with indoor lounge and panoramic lounge bar multifunctional lounge games room gym solarium outdoor pool complete with furnishings and Functionally Functional Equipment Catastally Identified Fg 17 Chapter 4040 sub 1 and sub 2 Fg 17 Chapter 4039 sub 1 and sub 2 and sub 3 of the Commune Censuario of San Teodoro OT Landfill Buildings Bankruptcy No 4 2016 of the Court of Nuoro Sale to the senses of the art 107 co 1 L F The property is located in San Teodoro OT Register to the website to download sale adviceIn order to be able to participate in the auction you must register on the website www industrialdiscount it following the instructions indicated therein and also send it by registered letter with acknowledgment of receipt or hands to be delivered indisputably at the IT Auction s r l in closed envelopes and without any sign of acknowledgment by 25 July 2018 at 12 00 irrevocable purchase offer The following are the minimum auction prices for the purchase of the goods Business Complex Single Lot Estimate Euro 13 300 000 00 Base price Euro 4 208 204 00 Minimum bid 75 of the base priceDownload the details from the documentation section

Ongoing business
25/07/2018
12:00
CET
Auction 2195
Add to Watchlist
-68%
Company branch of a hotel complex - Lot (Auction 2195)
1 Lots

Hotel owned business area consisting of a hotel complex restaurant with indoor lounge and panoramic lounge bar multifunctional lounge games room gym solarium outdoor pool complete with furnishings and Functionally Functional Equipment Catastally Identified Fg 17 Chapter 4040 sub 1 and sub 2 Fg 17 Chapter 4039 sub 1 and sub 2 and sub 3 of the Commune Censuario of San Teodoro OT Landfill Buildings Bankruptcy No 4 2016 of the Court of Nuoro Sale to the senses of the art 107 co 1 L F The property is located in San Teodoro OT Register to the website to download sale adviceIn order to be able to participate in the auction you must register on the website www industrialdiscount it following the instructions indicated therein and also send it by registered letter with acknowledgment of receipt or hands to be delivered indisputably at the IT Auction s r l in closed envelopes and without any sign of acknowledgment by 25 July 2018 at 12 00 irrevocable purchase offer Read the sale adviceThe following are the minimum auction prices for the purchase of the goods Business Complex Single Lot Estimate Euro 13 300 000 00 Base price Euro 4 208 204 00 Minimum bid 75 of the base PRICE APPROXIMATELY REDUCED BY 68

Ongoing business
25/07/2018
12:00
CET
Auction 3160
Lot 2
Add to Watchlist
Plastic Material Moulding Department - Lot 2 (Auction 3160)

Fallimento n 214 2017 del Tribunale di Monza cessione dell azienda O M P Micro Precision srl sita in Agrate Brianza MN Reparto Stampaggio Materie Plastiche Zona stampaggio Scaffalature soppalchi carrelli elevatori e altre attrezzature Zona controllo e pesatura Clean Room e uffici Compressori Automezzi Dalla sezione Documentazione scarica il Pdf Allegato 2 per visionare l elenco completo dei macchinari inclusi in questo repartoGuarda il video del lottoTechnical data sheets available upon request

Ongoing business
25/07/2018
17:00
CET
Auction 3160
Lot 1
Add to Watchlist
Construction Molds Department and Precision Mechanical Machining - Lot 1 (Auction 3160)

Construction Molds Department and Precision Mechanical Machining Electrical discharge machining area Traditional grinding area Planetary grinding Plunge spark machining area Milling cutter area Quality dimensional control area Workshop assembly area Offices Compressors Downalod from the documentation section the pdf Allegato 1 for a complete listing of the assets included in the sale of Construction Molds Department and Precision Mechanical Machining Watch the videoTechnical data sheets available upon request

Ongoing business
25/07/2018
17:00
CET
Auction 3160
Add to Watchlist
O M P Micro Precision ongoing business - Lot (Auction 3160)
2 Lots

Bankruptcy n 214 2017 of the Court of Monza O M P Micro Precision srl located in Agrate Brianza MB Sale of the company complex consisting of the assets organized for the production of molds special equipment blanking and molding of plastic materials consisting of goodwill plant machinery and employees In order to attend the auction it is necessary to register on the website www industrialdiscount it and send by registered mail or by hand to be delivered without delay to the head office of IT Auction s r l in Via Galilei n 6 Faenza RA in a sealed envelope and without any sign of recognition within and not later than the 25 07 2018 at 09 00 irrevocable purchase offer The starting price for the whole complex is equal to 649 000 00 The price offered can not be less than 75 of the starting price plus statutory taxes and transfer charges to be borne by the winner as regards the entire company complex For further information please download from the documentation section sale notice and regulation complete asset list Upon request the technical data sheets of the main machines

Ongoing business
25/07/2018
17:00
CET
Auction 2364
Lot 1
Add to Watchlist
-20%
Building intended for tourism and restaurant structure - Lot 1 (Auction 2364)

Sale of the ongoing business constituted by a building complex destined for tourist accommodation and catering called Domus Aurea The complex is located in Agrigento https goo gl maps kNJr4u7guKP2 inside the archeological park of the Valle dei Templi The building includes a floor level provided with bedrooms complete with a restroom each hall reception stairs and elevator In the first floor are more bedrooms The second floor not reachable by elevator is at terrace use with panoramic view on the Valle and solarium relax area External area of approximately 5 800 square meters include wide paved area in south side of the hotel for external restaurant use includes bar counter Green area paved and with benches Parking areasThe building includes professional equipment and machinery restaurant furniture and bar reception areas bedroom furniture and complements office furniture and equipment The interested parties can download from document section the following General layoutReal estate valuation

Ongoing business
30/07/2018
09:00
CET